McDonnell Genome Institute

Washington University

CircRNA

chr6|166423255|166432490|-|RPS6KA2|ENST00000265678.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.904

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

4

Peptide

AGNGLLMTPCYTANFVAPEIIDK

Amino Acids from 5' Exons

VVHRDLKPSNILYRDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPE,LFIETSRVTSCTGMSRGAQNPSESATSALPSSCARGTGCSHPATRPISWPR,CSSRPEAEHPVQGVGEPRIHPSLRLRLCQAAARGERAAHDTLLHGQFRGPG

Amino Acids from 3' Exons

IIDKSKRDPSEEIEILLRYGQHPNIITLKD,SLIRARETPRKRLRSSCGTASTRTSSPSR,HEQERPLGRDDPPAVRPAPEHHHPQG