McDonnell Genome Institute

Washington University

CircRNA

chr6|160048374|160063630|+|IGF2R|ENST00000356956.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9611

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

AGTAGISQSGSLAK

Amino Acids from 5' Exons

SGKIRWPWRKLVCHGQLRGTCHVEEILHRVSASESSAGLQPICIGLPDEVKRS,LAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQ,WQNLKVALEETGMPWTTQGNMSRGGNTTLTCVGLIQCRAATDMHRLARSMKKI

Amino Acids from 3' Exons

GTTVRKTQGMATCMTSPWASTTPSALANTLITSGSVGSFPQTSAPQVTSPRWSPHVRKSGNRRDFTKWQ,GQLGERPKAWQLVPEAPGPQRHHRERWRIHLLLPGLWEAFLRRLPHKQVQGGLLMSGKAGTAGISQSG,DNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFRVCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVA