McDonnell Genome Institute

Washington University

CircRNA

chr6|159688125|159692863|-|SOD2|ENST00000546260.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9109

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

TGLSVEENSLR

Amino Acids from 5' Exons

EMLQPRLFSLHSSMVVVISIIAFSGQTSALTVVENPK,RCYSPDSSSACTEVQWWWSYQSHFLDKPQPRWWRTQ,DVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPK

Amino Acids from 3' Exons

HQQAAGSGFGVSGLQAEAQPPRPALRLRRPGTSHQRADHAAAPQQAPRGLREQPERHRGEVPGGVGQGVPGAAGGSPRQRRPQGARPHTDGPLRGGELASYLYRFRVFQ,TSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGRFQAERREAVPGRGDPREPGPIRTGLSVEENSLRICTGSEFS,PAGSWLRFWGIWAPGRSTASPTCPTTTAPWNLTSTRRSCSCTTASTTRPTTTTSPRRSTRRRWPRVGSRLSGGRQSPAEATPGSQAPYGRASPWRRTRFVFVPVPSFP