McDonnell Genome Institute

Washington University

CircRNA

chr6|15533239|15627475|-|DTNBP1|ENST00000338950.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9106

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

15

Peptide

LQSGELVDSEVVMLSAHWEK

Amino Acids from 5' Exons

LNMQSTPRRSWKWSTPSKSRSGRSFLRKPSSRTWSSTCPLATCRLQSGE,TRCRARPEGPGNGAHPANEAEGAAEVFGSLPAGHGAVPVHWLPADCRAA,ELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQYLSTGYLQIAERR

Amino Acids from 3' Exons

LVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANL,WWIARWSCFLRTGRRKRQASWSCKSSSSSSQLSQTNPQQI,GGRGGHAFCALGEEKDKPRGAARAAPAAPSFNRRLRIHDSKS