McDonnell Genome Institute

Washington University

CircRNA

chr6|154410342|154442290|-|CNKSR3|ENST00000479339.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9515

24

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

3

Peptide

LLMGTGWGLWTLLPDLEVMAGK

Amino Acids from 5' Exons

ASHGLCPCLLMGTGWGLWTLLPDLEVMAGK,QATAFVHACWELDGDCGPFCQTSRSWQE,KPRPLSMPADGNWMGIVDPFARPRGHGRK

Amino Acids from 3' Exons

NYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEFLTSVVELIGAAKALLAWLD,IMASKLITRTWFNEHLPTIYRITVADGKVPLTMATPPARPPMSSPRWWSSSAPPRPCWRGWT,LWPRNHEELGSETESIFPQFTELHKPTEKSRLRWQHLPQGPQVPDLGGGAHRRRQGPAGVAGP