McDonnell Genome Institute

Washington University

CircRNA

chr6|152373036|152376912|-|SYNE1|ENST00000341594.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9866

55

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

ESALEEILDALQK

Amino Acids from 5' Exons

EFLSESENGQHKLNMMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALE,SFCQKVKMDSTSTCCLKGNFVPCPKRKRKGSRPKLQLQKKIGKIFIQISTKKNLL,VFVRKKWTAQAKHDAVRGTSEYPADQRESERDPGQSYSCKRRLEKFSFKSPPKRICSR

Amino Acids from 3' Exons

EILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYN,RYWMLCKKQSLEQRISSLSMNFVDFPETVPTVEKFLALKSII,DTGCFAKSRANRGSQVSAETLSIFQRPEYLQWKSFWLDRVL