McDonnell Genome Institute

Washington University

CircRNA

chr6|152367217|152373219|-|SYNE1|ENST00000341594.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9749

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

12

Peptide

LEEFLSESENGQHK

Amino Acids from 5' Exons

EKVSRLDRIVAEHNQFSLGIKELQDWMTDAIHMLDSYCHPTSDKSVLDSRTLKLE,RKCQDWIESLQNTISSLLGLKNYKTGRMRFTCWIHTATRHPTKVCWTAGRSSS,ESVKTGNRCRTQSVLSWDRITRLDDGCDSHAGFILPPDIRQKCAGQQDAQAR

Amino Acids from 3' Exons

EFLSESENGQHKLNMMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALE,SFCQKVKMDSTSTCCLKGNFVPCPKRKRKGSRPKLQLQKKIGKIFIQISTKKNLL,VFVRKKWTAQAKHDAVRGTSEYPADQRESERDPGQSYSCKRRLEKFSFKSPPKRICSR