McDonnell Genome Institute

Washington University

CircRNA

chr6|152239532|152242440|-|SYNE1|ENST00000341594.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9027

76

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

13

Peptide

GVELEYILEDMYDELMMIIGSR

Amino Acids from 5' Exons

EYFQGLESHMILTETLFRKIISFAVQKETQFHTELMAQASAVLKRAHKRGVELEYILE,NTFRAWNLISLKHSSERSALQSKRKPSSIQSWLRLLLYNGLTRGVWSWSTF,ILSGPGISYDLDNTLQKDNQLCSPKGNPVPYRADGSGFCCTETGSQEGCGAGVHSR

Amino Acids from 3' Exons

DMYDELMMIIGSRRSGLNQNLTLKSQYERALQDLADLLETGQEKMAGDQKIIVSSKEEIQQLLDKHK,TCMMSSLAPGGVVIRTLHSRVSMRGPYKIWLTCKLVRRRWQETRKSSCLPKRKSSNYLTNI,HVADDDHWLPEEWSESEPYTQESVEGPTRSGPARNWSGEDGRRPENHRVFQRGNPATTQT