McDonnell Genome Institute

Washington University

CircRNA

chr6|152224493|152232265|-|SYNE1|ENST00000341594.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.947

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

5

Peptide

LLTGSLEAVQVQVDNLQLQMDK

Amino Acids from 5' Exons

VGQLKILLKSVLDQWSSHKVAFDKINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQ,LDNRYCNQCLTNGVVTKWPLTRTVTSWRPDTLFPDSVCLAPKLCKFRWTIF,WTIKDTAEISAPMESQSGLQDKQLPHGGQILSFPIPSADWLLRSCASSGGQSS

Amino Acids from 3' Exons

LQMDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYK,SRWINCLPAMPFLKSVGFLWKMLFRRMKIILKIPVTRQFMNTFRNI,PDGTAFPPCHFSHELDFSNGKCYSEGRYKFHRLQGNSIPSEI