McDonnell Genome Institute

Washington University

CircRNA

chr6|148941278|149021481|+|UST|ENST00000367463.4

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

DFYLITSR

Amino Acids from 5' Exons

VLPFPSQVVYNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQ,YYLSQARWCTTGASVGAVLWSCFESCRRSTDLIWSHQTFTTKPGLLKMN,TTFPKPGGVQQGRQVWEPYCGLASENLVGEARIFGHIRHSQQNQAYKT

Amino Acids from 3' Exons

GAWMGPESKAEREKLPARGDSRVGRCAAVTGKIFTSLLQGRAQYLQRP,EPGEWALERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDP,SLVNGPLREQSTMKTSCSWGFLKSWKMCCCYWKDFYLITSRACSVSTKTQ