McDonnell Genome Institute

Washington University

CircRNA

chr6|145910447|145955354|-|SHPRH|ENST00000275233.11

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9223

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

NLVCLYLR

Amino Acids from 5' Exons

WAVLTCGHCFCNECISIIIEQYSVGSHRSSIKCAICRQTTSHKEISYVFTSEKANQEEDIPVK,GRYPVVTVSVMNAFLLLNNTAWDLTEAPLSVQSAARPHLTKKSRMSLPQRKQTRRRTSL,GGTDLWSLFLMHFYNYTIQRGISQKLHVCNLPPDHISQRNLVCLYLRESKPGGGHPCE

Amino Acids from 3' Exons

SSQLPAKKTKAADGNVLLQGMRKRGSSFIGICMRTEGMNLSSVMMTSSPAQVQIPLLLIISFVIVRKKWLTEIRRGVQKWASQNQLKKKRLLVFFPLCLSILFLPIILIIPGKHFENLFSFFLHRVLKIFPKGVLHVQSQAISSFMFIQKVKMRNKKKNRVFVTRVFWWSHPSVVKCKIWGGYKRREENSIRNQKEITLS,VHSYQPRKLENEQPTETCSSSEGRGKEAAASLEYAGQKETYHHKRAALPRFRYLFCSLYHSKSKGRSGSQREEVFKSGELLKTNKRRDCWYFFPFVCKVKYCDFSLSFFLESISRRINSSASSCTEFNKFFRKEYYIDEFRVKQSVPDLCSFKRRCRETKKRTDEYLQGYSGGVILQWNVRRFGVATKEEKNKTLSETRRKSHYQ,FTVTSQENLKMSSRRKRAPPVRVDEEKRQQLHWNMHEDRRNEPIIISDDDEQPCPGSDTSSAHYIILSDSLKEEVAHRDKKRCSKVVSFSKPIEKEETVGIFSPLSVKLNIVISPYHFDNSWKAFLGELTLQLLPAQSLIENFSERSITLMSSESSNQFLIYVHSKGEDVEKQKKEPMSICDKGILVESSFSGEMLEDLGWLQKKRRIKLYQKPEGNHIIK