McDonnell Genome Institute

Washington University

CircRNA

chr6|145635244|145686296|-|EPM2A|ENST00000367519.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9959

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

1

Peptide

QVEHVTIK

Amino Acids from 5' Exons

NSTKYLAGLPSSGGTCNHQTEAIGDYSCNEFPDMGYCTEFLRLPLPRAHDSRHYDTIGRRLGLHLDANTRYEHR,ILPNIWLGSCPRQVEHVTIKLKHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTE,FYQISGWVAALVRWNMPSNSMNWGLQLISRLNGILYRIPQAVTATQSPLQTLLNYIGKKAWPTSGCQHQIAPK

Amino Acids from 3' Exons

AMDLIMTVAVLTMKTTWWMVCIVSQDTGLRPLGTPMKSTQQTSILILQATKPCIIQ,QWTSSPLLYLQKQLGGWCVLSPNRTLDGHWAHQNEAHNRLLFYCRPPSHALFK,NGPHHDRCCTYNENNLVDGVYCLPIGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYS