McDonnell Genome Institute

Washington University

CircRNA

chr6|144835779|144836541|+|UTRN|ENST00000367526.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9146

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

7

Peptide

LRQLLEQGRR

Amino Acids from 5' Exons

GRRARPHPAVLPNTRRRVPSEPAAEPSSDPEVSREGRTWRTGEDHCPGGRTK,EDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQ,KTSTPSSSSIAKHSEESPQASRRAQLRSSQRGKNVENWRGSLLTWRKNK

Amino Acids from 3' Exons

KSTGGVAAEGPAPPKGAPCRFTARVDYISPSHVGFRTYSRSKTPQAAQRSAGGDADFRRSQTAGVSAPPPPTAAGA,NLQVEYEQLKDQHLRRGLPVGSPPESIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ,IYRWSMSSRTSTSEGGSLSVHRQSRLYLPITRLRIQNLQKQNSSGSTKVGWRLGCRFKITINSWSLSSTASDSCWS