McDonnell Genome Institute

Washington University

CircRNA

chr6|144533084|144542870|+|UTRN|ENST00000367545.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9058

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

4

Peptide

QGLLELEVGISSHQPSFAALNR

Amino Acids from 5' Exons

ELEVGISSHQPSFAALNRTGDGIVQKLSQADGSFLKEKLAGLNQRWDAIVAEVKDRQP,NLRWASAATSPVLQHTELGMGLCRNSPRQMEASKKNWQVTNAGMQLLQKRIGSQ,TGGHQQPPAQFCSTKPNWGWDCAETLPGRWKLLERKTGRFKPTLGCNCCRSEGAAK

Amino Acids from 3' Exons

ICREVPTTLKECIQEPSSVSQTRIA,FAERCLPPRNASRSPVLFHRQGLL,LQRGAYHPEGMHPGAQFCFTDKDC