McDonnell Genome Institute

Washington University

CircRNA

chr6|144458769|144751952|+|UTRN|ENST00000367545.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9307

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

5

Peptide

METFTEGLPTEEIK

Amino Acids from 5' Exons

KAFLLKKKMFWRRFHQNGRMYLNIWKIKERFSYRKIMLISSSLMSLKRSSRQRRSGNTLPFLNLPGSPCQARIPV,RPSYRNKKCSGEGFIRMEECISTFGRSRKKDSATGRYKCLFQAAAKGHQDKGGVGKTHFHFIFPAVLAKLEGFLS,GLPTEEIKNVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDSCQ

Amino Acids from 3' Exons

AFREEIAPINFKVKTVNDLSSQLSPLDLHPSLKMSRQLDDLNMRWKLLQ,HLEKKLHQSTLKLKRMIYPVSCLHLTCIPLRCLASMTLICDGNFY,IRRNCTNQLSNGEFIQSAVSTPASLSKDVSPARPYAMETFT