McDonnell Genome Institute

Washington University

CircRNA

chr6|144453781|144462866|+|UTRN|ENST00000367545.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9562

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

AFEALEK

Amino Acids from 5' Exons

ALEKEQRERIPRADELNQTGQILVEQMGK,HKKNREKESPEQMNTKLDKSLWSKWEK,IRKRTERKNPQSRIKPNWTNPCGANGK

Amino Acids from 3' Exons

TLDEILENQKPALHKLAEETKALEKNVHPDVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEIALTLRAFE,PLMKSLRIRNLHYINLQKKQRLWRKMFILMKNYISKNLMMCKESGTSRSWFPKIYICLRKLLSHSELL,PNPESETCITTCRRNKGSGEKCSSCRKIIARICARKVEQAKGLGFQRSTFAGNCSHTQSF