McDonnell Genome Institute

Washington University

CircRNA

chr6|144440351|144577288|+|UTRN|ENST00000367545.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9558

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

QQMQSLQSDLEAEQVK

Amino Acids from 5' Exons

SLQSDLEAEQVKVNSLTHMVVIVDENSGESATAILEDQLQ,VCKVILRLNRKIHLTWWSLLMKTVVRVLQLSKTSY,FAKSGTGESKFTNSHGGHCKQWECYSYPRRPVT

Amino Acids from 3' Exons

YCQTERLGGVEDGAGLSQRSGKLPEVDPRSRDHSECACGCLSSGECSSGYLGQGTQTADA,IADRQNALEAEWRTVQASRRDLENFLKWIQEAETTVNVLVDASHRENALQDSILARELKQQMQ,LLTDRTPWRLSGGRCRPLAEIWKTSSGSKKQRPQMCLWMPLIGRMLFRIVSWPGNSNSRC