McDonnell Genome Institute

Washington University

CircRNA

chr6|144423548|144436138|+|UTRN|ENST00000367545.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9602

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

DQFATHEPK

Amino Acids from 5' Exons

PKERGSTRVHALNNVNRVLQVLHQNN,QRNVVPQGYMPITSTECCRFYIRT,KGTWFHKGTCLKRQQSAAGFTSEQ

Amino Acids from 3' Exons

STAPEEEHESPRAETPSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHE,VQRLRRSMRVPELKLPALSLRLTWIWTAIRLRWRKCPGCFLLRTLSRSRMIFLMMLKKSKTSLQPM,YSAGGAESPSNSQHCHGHGSGQLSDCVGGSADLVAFCGHFPGAGYFCRSQRPVCNP