McDonnell Genome Institute

Washington University

CircRNA

chr6|143765260|143807133|+|PHACTR2|ENST00000305766.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9125

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

RVDSLQAGSSHSK

Amino Acids from 5' Exons

LAPLIQKKQLALKHQLRHPLHPPHLVPKLQRRQFLAKQGQWGPPRAREKLTSSQLLTCPQTQQLLAHPTKESLQRPEWRVSNSNRLSLELRSRTQANSSPWSLHPLWLQHLLLWPPLSLLRISALLPQTLQLSSSALELTCPSLPTQVSFFGLKSRRTEPLSTQALAVLTEKMQN,WLLSFKKNNWLSISFAIHFIHLISSQSFKGDSFQSRDSGDHQGQEKNQAANNFSPVLRHNNFWHIRPERRACRDQSGEFQTRTDCPWSGAEHRQIQVHGPSTPCGSSTFSSGPPSPSGSVHYCLRHSSCPRQRWSPARLCLRPKSASLGRADEQNHSLLRHWLKCQRKCKM,GSSHSKKTTGSKASASPSTSSTSSRPKASKETVSSKAGTVGTTKGKRKTDKQPITSHLSSDTTTSGTSDLKGEPAETRVESFKLEQTVPGAEEQNTGKFKSMVPPPPVAPAPSPLAPPLPLEDQCITASDTPVVLVSVGADLPVSALDPSQLLWAEEPTNRTTLYSGTGLSVNRENAK

Amino Acids from 3' Exons

AAIRKELNEFKSTEMEVHEESRQFT,QQGKNMNLKAQKWKFMKRVDSLQ,SNKERTKIKHRNGSSRESTVYK