McDonnell Genome Institute

Washington University

CircRNA

chr6|142769551|142783615|-|HIVEP2|ENST00000367603.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9704

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

4

Peptide

STALETLHESALLSGELALK

Amino Acids from 5' Exons

IILSNWQLNFALVDGQNFSTIHHPNFILVENFQMPEIFIDLHLAFGWTFLQWRELCYSPGPRTLLANAHRLWCACGRFQREGAISKFADTLEHGSNQALRSTALETLHESALLSGELALKTLCNKMDTGDTALGQKATSRSGETDKASGRWRQEQSAVIKMSTFGSHEGQRQPQIEPEQIGNTASAQLFGSGKLASPSEVVQQVAEKQYPPHRPSPYSCQHSLSFPQHSLPQGVMHSTKPHQSLEGPPWLFPGPLPSVASEDLFPFPIHGHSGGYPRKKISSLNPAYSQYSQKSIEQAEEAHKKEHKPKKPGKYICPYCSRACAKPSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHAHAIKAGLVPFTESAVSKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLFAEASDKMSPGPPIPLDIASRGGYHGSLEESLGGPMKVPILIIPKSGIPLPNESSQYIGPDMLPNPSLNTKADDSHTVKQKLALRLSEKKGQDSEPSLNLLSPHSKGSTDSGYFSRSESAEQQISPPNTNAKSYEEIIFGKYCRLSPRNALSVTTTSQERAAMGRKGIMEPLPHVNTRLDVKMFEDPVSQLIPSKGDVDPSQTSMLKSTKFNSESRQPQIIPSSIRNEGKLYPANFQGSNPVLLEAPVDSSPLIRSNSVPTSSATNLTIPPSLRGSHSFDERMTGSDDVFYPGTVGIPPQRMLRRQAAFELPSVQEGHVEVEHHGRMLKGISSSSLKEKKLSPGDRVGYDYDVCRKPYKKWEDSETPKQNYRDISCLSSLKHGGEYFMDPVVPLQGVPSMFGTTCENRKRRKEKSVGDEEDTPMICSSIVSTPVGIMASDYDPKLQMQEGVRSGFAMAGHENLSHGHTERFDPCRPQLQPGSPSLVSEESPSAIDSDKMSDLGGRKPPGNVISVIQHTNSLSRPNSFERSESAELVACTQDKAPSPSETCDSEISEAPVSPEWAPPGDGAESGGKPSPSQQVQQQSYHTQPRLVRQHNIQVPEIRVTEEPDKPEKEKEAQSKEPEKPVEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHSSGESSFESTGTGLSRSPSQESNLSHSSSFSMSFEREETSKLSALPKQDEFGKHSEFLTVPAGSYSLSVPGHHHQKEMRRCSSEQMPCPHPAEVPEVRSKSFDYGNLSHAPVSGAAASTVSPSRERKKCFLVRQASFSGSPEISQGEVGMDQSVKQEQLEHLHAGLRSGWHHGPPAVLPPLQQEDPGKQVAGPCPPLSSGPLHLAQPQIMHMDSQESLRNPLIQPTSYMTSKHLPEQPHLFPHQETIPFSPIQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTEIHSSYPLEHVAEHTGKKPAEYAHTKEQTYPCYSGASGLHPKNLLPKFPSDQSSKSTETPSEQVLQEDFASANAGSLQSLPGTVVPVRIQTHVPSYGSVMYTSISQILGQNSPAIVICKVDENMTQRTLVTNAAMQGIGFNIAQVLGQHAGLEKYPIWKAPQTLPLGLESSIPLCLPSTSDSVATLGGSKRMLSPASSLELFMETKQQKRVKEEKMYGQIVEELSAVELTNSDIKKDLSRPQKPQLVRQGCASEPKDGLQSGSSSFSSLSPSSSQDYPSVSPSSREPFLPSKEMLSGSRAPLPGQKSSGPSESKESSDELDIDETASDMSMSPQSSSLPAGDGQLEEEGKGHKRPVGMLVRMASAPSGNVADSTLLLTDMADFQQILQFPSLRTTTTVSWCFLNYTKPNYVQQATFKSSVYASWCISSCNPNPSGLNTKTTLALLRSKQKITAEIYTLAAMHRPGTGKLTSSSAWKQFTQ,SFYLSETGNTLLLMGKISPRLFIIPISSLKIFKCHKKSLICTLLDGRFYNGENCVIALVQGHYLMPIDCGVRVEGSKEKEQSASLQTPWNMEATKLEAQLWRHSMSLHCFQGNHLRPCVTKWTLGTQLDKKLPQGLEKLIKHQVDGDRNNQLLLRALLAVMKDSGNHKSLSKSETQHQHNCLVLGNWPPLVKWCSKSQRSNIHRIVRVLTHANTHSLSLSTHCHRGSCTAPSHIRASKVLRGFSLALCHPLPLRTYFLFLYMATVVVILEKRFQVTLLIANTPRKVLNRQKRLTRKSTNPKSLASTFALTAAERVPNLVYKNTSGPILGSGHIHVYLVVSLSRQRAICTSTGSHMPMQLRQDYLSQSQLYLNWTRLVLLMKQKYIQMVNRVQTQMRRVLYLPRLLTKVLVHPSHWTLPAEAAIMGHWKNHWEVQRCRFLSLKVGFLSLMKALSILALICYQIHLILRLMIRTQSNRNLHDCQRKKDKILSHRSTFARTVKEALILVTFLAQKVLSSKALPTQMQSLMKKSSLENTVGLVREMHSVLQPQVRSVPQWVGRAWNHYLTLTPGMSRCLKILFHSSQAREMSTPVKRACNPLSSTVSPDNPRLFHHLSGTKENFIQQTSKAATRFSKLLTLHPLLEATQCQLLQQLILFLLLEEVTHLMKGLVPTMYSIQGPWAYPLSACEDKRHLSCLRYRRATWKSSTMAGCRVSAVHPRKRNCLLGTGLGMTMMSVGNPIRSGRTLKHQSKTTGTFPAVLSMVENISWIPWCHCREYQACLELPVKTGNAGKRRAGMKRTRPSAAALALLWASWLPIMTPNCRCRKESGVDLPWLDTKTFLMVTRNALTHVGPNCSLEVHLLCQRSHLQPLIQTRCQTGAGNLLEMFLFSTPTHADPIHLKGLSQPNLWLAHRIKPLPLQRLVTVRFQKPQVLSGLHLGMVQKVGGNPLHLSRCSSSPITHSPGFGNTTSRFLRFEPRSLINLRRRRKPRAKSQRSLWKNFSGPREVRPFPSSPRRSCHPKRSVCDLQIWSTPQGSPALNPQAQASPAAPAKKATCPTAPVSPCLLKEKKPVSFLHFLSRMSLGSIQSFLSLLVHTHCLSQAITTRKRCDAAHQSRCLVLTQRKSQKFGANHLIMGICPMLLCREQQPPRYHRPGRGRNAFWCGKLPSVAPQKSPRARLAWIRASKSSWSTCMLASGPGGTMARLLCCLLFSKRTQGSRWRVLVPRARGHCTWPSHRSCTWTVRNLEIPSNQHPIQASTYLNSHTYFHIKRQFHFLQSRMPCFSFSILQFVWFIYQLSSLPGGRHISHIPLLSTLRRAMASPLFRQKSIRAIPSMWQSTLERNLLSMHTRKSRPTHVIQEHQGYTQRTFFQSFHQTRAVSQLKRPLSRFFKKILPRQMLGLCSPSQEQWFLFGSRRTYHPMEVSCTQAFLRYLGRIALPLSYAKSMRIPKGHWSPTQPCKGDSTLPRCWGSMRAWRSTPFGKHLRLCPSANPPSPCVYLPPLTAWPPWEVASECFLQPVAWSSSWKPSSRKGSKKKRCTDRLWRSLVLWSPTQTSKRTSPAPRNPSWFDKDVLLSQKMACSQGHLPSPRCRPPHLKTILLLARLPGSHSCPARRCFPVPGHHFRGRSPVGLLKAKNLQMNISMRRHRTAAHRVLHYQQEMVSWKRKGRATSGLLACWSAWPLPPAGTWQTQLFFSRTWQISSRFFSSPVCGQQLLVGASIIQNPIMCNRPPSNPRFMLHGALVPVIQTHQDTPRPRWLFGPSKKSLQKFILWLLCIGLEPASLHHQVLGSSLL,HFILVKLAIELCSSWAKFLLDYSSSQFHPSKFSNAIRNLYRFALSFWMDVSTMERTVLPWSKDITSCPSTVVCVWKVPKRRSNQQVCRHPGTWKQPSFKKHSFGDTPVCTAFRGTSTDLVQNGHWGHSSRTKSYLKVWRNSIRMETGTISCYDEHFWQSRTAATTNRAANRKHSISTTVWFWETGLPSGAASRREAISTASSESLLMPTLTLFPSALIATGGHAQHQATSEPRRSSVAFPWPFAIRCLGLISFSYTWPQWWLSKKDFKSEPCLPILPEKYTGRRGSQERAQTQKAWQVHLPLLQQSVCQTCTEKTHQVPYWGAAISMYTLWFLFQDKEQFVQAQEVTCPCNGRISTFHRVSCIIGPRGWFYCRSRNTFRWTEYRHRGEFFICRGFQNESWSTHPTGHCQQRRLSWVIGRIIGRSNEGADFDYPKWDSSPKLSVYWPYATKSIFKYGFAHSQTETCTKTVREKRTRFAIAQPSEPAQRKHFWLLFSLRKCAANKPSQHKCKVLRNHLWKILSASEKCTQCYNHKSGACRNGEGHNGTITSRHQVRCQDVRSCFTADPKQGRCRPQSNEHAEIHVQQVQTTPDYSIIYQERRKTLSSKLPRQQPGSLRSSCRLFTPYKQLSANFFSNSNYSSFFERKSLIKDDWFRRCILSRDRGHTPSAHAKKTSGIAAFGTGGPRGSRAPWQDVEGYQQFIPEGKEIVSWGQGWVLCLSETLEVGGLNTKAKLQGHFLLEFFKAWWRIFHGSRGAIAGSTKHVWNYLKQETPEREERRGRGHAHDLQQHCKHSCGHHGFRLPQTADAGRSQEWICHGWTRKPFSWSHGTLPMSAPTAAWKSISCVRGVTFSHFRQDVRPRGQETSWKCDFCDSAHQLTEPTQFIKVVSRTCGLHTGSPFPFRDLQDFRSPSESVGSTWGWCRKWGETLSISAGAAAVLSHTAQASSATQHPGSDSSDRGATEGEGSPEQRAREACGRISVAPEKDPFPAPRGEVATQKEASATCRYGALLRGVQLIHRHRPLPQPQPRKQLVPQLQFLHVFKRRNQAFCTSAGVWEAFRVSDCPCWFILIVCPRPSPPERDATLLIRADALSSPSGSPRSSEQIILWESVPCSCVGSSSLHGITVQGEEEMLSGAASFLQWLPRNLPGRGWHGSEREARAAGAPACWPPVRVAPWPACCAASSSARGPREAGGGSLSPAELGATAPGPATDHAHGQSGIFEKSLDPTNILYDKQALTTATLISTSRDNSIFSNPECLVSVSVSYSLYGSFTSSAASLVAGTFPTSLCSAPSEELWQALFSDRNPFELSLRACGRAHWKETCVCTHERADLPMLFRSIRATPKEPSSKVSIRPEQVNNALAGSSRRFCLGKCWVFAVPPRNSGSCSDPDARTILWKCHVHKHFSDTWAEPCHCHMQSREYDPKDTGHQRSHARDRIQHCPGAGAACGLGEVPHLESTSDFAPRLRILHPLVFTFHLQRGHPGRQANAFSSQLGALHGNQAAEKGQRRKDVRTDCGGACCGADQLRHQKGPLPPPETPAGSTRMCFAKRWLAVRVIFLLLAVALLISRLSFCPVFQGAIPAQQGDAFRFPGTTSGAEVQWAFKQRIFRIRYRDGIGHEHEPTEFFITSRRWSAGRGREGPQAACWHAGPHGLCPQRERGRLNSSSHGHGRFPADSSVPQSADNNYCELVLLELYKTQLCATGHLQILGLCFMVHFLSKPIRIEHQDHAGSSEVQAKNHCRNLYSGCYAAWNRQAYIIKCLEAVYS

Amino Acids from 3' Exons

IPRSCAVPVRRVGILEIKDGCDAVFYEDN,FPEVVHEFLGELASWKSKTVVMQFFDMRIT,SQKLCMSSCEESWHLGNQRRLCSFLIGQ