McDonnell Genome Institute

Washington University

CircRNA

chr6|139244594|139262773|-|RP1-225E12.3|ENST00000612486.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9785

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

6

Peptide

ALLDMIEEEEALQR

Amino Acids from 5' Exons

TTKKMKKLEKDTATWKARFENCNKALLDMIEE,QLRKRSWKRTQPHGKPDLRTVTKLCWTLK,NENEEAGKGHSHMESPIELQSSVGHDR

Amino Acids from 3' Exons

EEALQRAREEEEKRKEITSHFQSTLTDIQGQIEQQSERNMKLCQENTELAEKLKSIIDQYELREE,KRRFSGHVRKKRKGRKSQAISRVPSRTSRARSSSRVSEISSVRRTQSLQKSKASSISMSSER,RGASAGTGRREKEGNHKPFPEYPHGHPGPDRAAEAKYEALSGEHRACRKAEKHHRSVAQRG