McDonnell Genome Institute

Washington University

CircRNA

chr6|138779821|138785381|+|CCDC28A|ENST00000332797.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9541

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

LLSDSDERK

Amino Acids from 5' Exons

SDERKDQTSGWRGQRRSVNSDPALLPHCLRCSGDGERAAQSFEFPLWKTSSI,VMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAF,KKRPNLRVERAKALSQLRSSTPSSLMSQMFRRWREGCSVFMISTLENFKHL

Amino Acids from 3' Exons

EMNVPLNRWNMFGECRRNLAIWSSMGSRNFLRIREKQPVTPIWIGFCQ,KMFHTDGTCSGNAGEISSLEFGALWGVRGTSGEKNSQLQSGASVR,NECSIEQMEHVRGMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSD