McDonnell Genome Institute

Washington University

CircRNA

chr6|138776078|138779985|+|CCDC28A|ENST00000332797.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

60

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

MISTLENFK

Amino Acids from 5' Exons

VLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPKLK,SEAGRGAIRNLKQWKSGKRGGVLSLLVPTVLRLSMPKKMPFQVKAQGFQILHHSQLHSDQSK,LKKLAVVQGTNNGRAESEEEESVFCPLYSGCQCQKKCHSSEKHRVFKSCITVNFTATKVKK

Amino Acids from 3' Exons

SDERKDQTSGWRGQRRSVNSDPALLPHCLRCSGDGERAAQSFEFPLWKTSSI,VMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAF,KKRPNLRVERAKALSQLRSSTPSSLMSQMFRRWREGCSVFMISTLENFKHL