McDonnell Genome Institute

Washington University

CircRNA

chr6|138441982|138473433|-|NHSL1|ENST00000343505.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9991

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

TITGVPDNIQK

Amino Acids from 5' Exons

GRISIARPAFGGLFTQTLWDDRRKSKGERLLQESLTTYRRS,GEFRSPGQPSAVSNLHRHSGKTTEESQKEKDYYRSPQHTEGA,ENFDRQASLRRSLIYTDTLVRRPKKVKRRKTITGVPDNIQKEL

Amino Acids from 3' Exons

NAISCGMMATAVLSTTLRDPPLRPTPAHSVMITKMKMKKQIK,MRVAAWLPQFSVLLSGTHLCGQRQPILLPRRRNRSK,CDKLRHDGYRSSQYYSQGPTFAANASPFCDDYQDEDEETDQK