McDonnell Genome Institute

Washington University

CircRNA

chr6|137878431|137879351|+|TNFAIP3|ENST00000237289.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9796

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

KQTLDEANLPK

Amino Acids from 5' Exons

VGSLTKRNQSGRLLTCSAVQEMAGKQRAGEERGARPESHGTFRAPAFSHGCKMNAQLPLLHVCEHPAFMPVLREAAKESKQTPKAELQAGPGAPWHGARGLSGRSLALGVEPGVHWGASFGPTDSTQPFSVQDHCHEVQEPRLPLHTECAAQRILTLPQRPATSRQPRPRPHKALGSREVPSLPPGCYQDIWDLQYLLQKDYSRGLLQPQHQPPSFLSPAFQVRSLAARPEPLPAFLPQSWKRRPCWLPVSSCTDSWGQDGDEQVQKSRLRVFWDSRKQGLLHTVFHRVQRKQ,LDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENK,WMKLTYQKKSIWMITLNLFSMSTRNGRKTASRGGERGTPRIPWNLPCPSFLSWMNVKRPTAPSSCLTPSLYAMSAQRGGKRIKTNSQSTPSRALRGSLAWRSGPLGEKPMSPWRGTLRSPLGGLIRPHRQHPALFCSVRPLPSAGAPAAPSHMCSTTDFVNVATTPGNFTPATPQTTQGTWIPGSAKPASRMLPGHLMGSAVLASKGLQQRPPPASAPASLLPVTSVPSQIPRGSSGAPPRILATELETTPLLAACLKLHGLLGTGRGRASAEKPAACILGLQKTRAFAHCVSSSTEKTN

Amino Acids from 3' Exons

VGSLTKRNQSGRLLTCSAVQEMAGKQRAGEERGARPESHGTFRAPAFSHGCKMNAQLPLLHVCEHPAFMPVLREAAKESKQTPKAELQAGPGAPWHGARGLSGRSLALGVEPGVHWGASFGPTDSTQPFSVQDHCHEVQEPRLPLHTECAAQRILTLPQRPATSRQPRPRPHKALGSREVPSLPPGCYQDIWDLQYLLQKDYSRGLLQPQHQPPSFLSPAFQVRSLAARPEPLPAFLPQSWKRRPCWLPVSSCTDSWGQDGDEQVQKSRLRVFWDSRKQGLLHTVFHRVQRKQ,LDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENK,WMKLTYQKKSIWMITLNLFSMSTRNGRKTASRGGERGTPRIPWNLPCPSFLSWMNVKRPTAPSSCLTPSLYAMSAQRGGKRIKTNSQSTPSRALRGSLAWRSGPLGEKPMSPWRGTLRSPLGGLIRPHRQHPALFCSVRPLPSAGAPAAPSHMCSTTDFVNVATTPGNFTPATPQTTQGTWIPGSAKPASRMLPGHLMGSAVLASKGLQQRPPPASAPASLLPVTSVPSQIPRGSSGAPPRILATELETTPLLAACLKLHGLLGTGRGRASAEKPAACILGLQKTRAFAHCVSSSTEKTN