McDonnell Genome Institute

Washington University

CircRNA

chr6|137871212|137879351|+|TNFAIP3|ENST00000237289.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9938

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LHGLLGTGR

Amino Acids from 5' Exons

VLESTMAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTN,CWRAQWLNKSFLRLCIAICGKLRYGRELQKTFLNLLMGSFIILKPCTDTHWKCSELASFVLSFGRSSTKPSSTETSRPPWKARRNSTGVEKSGSLWRKRT,VGEHNGTSPSSGFVFEQYAESCEDTGENSRRHFTYWDHSSFNHAPIHTGNVQNLPVLSSVSGDHPQSPHRQKHPGHPGKPEETQLVSRSPEACGAENE

Amino Acids from 3' Exons

VGSLTKRNQSGRLLTCSAVQEMAGKQRAGEERGARPESHGTFRAPAFSHGCKMNAQLPLLHVCEHPAFMPVLREAAKESKQTPKAELQAGPGAPWHGARGLSGRSLALGVEPGVHWGASFGPTDSTQPFSVQDHCHEVQEPRLPLHTECAAQRILTLPQRPATSRQPRPRPHKALGSREVPSLPPGCYQDIWDLQYLLQKDYSRGLLQPQHQPPSFLSPAFQVRSLAARPEPLPAFLPQSWKRRPCWLPVSSCTDSWGQDGDEQVQKSRLRVFWDSRKQGLLHTVFHRVQRKQ,LDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENK,WMKLTYQKKSIWMITLNLFSMSTRNGRKTASRGGERGTPRIPWNLPCPSFLSWMNVKRPTAPSSCLTPSLYAMSAQRGGKRIKTNSQSTPSRALRGSLAWRSGPLGEKPMSPWRGTLRSPLGGLIRPHRQHPALFCSVRPLPSAGAPAAPSHMCSTTDFVNVATTPGNFTPATPQTTQGTWIPGSAKPASRMLPGHLMGSAVLASKGLQQRPPPASAPASLLPVTSVPSQIPRGSSGAPPRILATELETTPLLAACLKLHGLLGTGRGRASAEKPAACILGLQKTRAFAHCVSSSTEKTN