McDonnell Genome Institute

Washington University

CircRNA

chr6|136377754|136389517|-|MAP7|ENST00000354570.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9362

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

STAALSGEAAAR

Amino Acids from 5' Exons

LAACSSAHGRAALLTDSRPHIRSWPEVKAQLPCLEKQ,SPPAAQPMGEQRCQTPDAHTFVPGQKKHSCLVWRS,RRLQLSPWESSVVNRLLTPTHSFLARSKSTAALSGEA

Amino Acids from 3' Exons

LQEKCGKEKSEPGSTTRSTWKSGRRGWRSRGRRRSGGGLLWRRSGGRDLRRT,CKRNSVVRKRRASQAALREAPGRAEEEVGGAEAEGGAEEGCCGGEAEAETGGQ,AREIVWLEREERARQHYEKHLEERKKRLEEQRQKEERRRAAVEEKRRQRLEEDK