McDonnell Genome Institute

Washington University

CircRNA

chr6|136147350|136173888|+|PDE7B|ENST00000308191.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

GDWHQEK

Amino Acids from 5' Exons

VQHTQGRLAPRKRKDYAFKDTSMHQGCFVELYHKPLCTCWMKTTLDKQ,YNILRGDWHQEKGEKTIKLSKILPCIKAASWNYTTSPSAPAGRLPWTSK,TTYSGEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQAR

Amino Acids from 3' Exons

NMSVLENHHWRSTIGMLRESRLLAHLPKEM,ICLCWRIITGDLQLACFENQGFLLICQRK,YVCAGESSLAIYNWHASRIKASCSFAKGND