McDonnell Genome Institute

Washington University

CircRNA

chr6|135196960|135199050|+|MYB|ENST00000341911.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9183

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

MLSESSLDPPK

Amino Acids from 5' Exons

DSSSWCDLSSFEFFEEADFSPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSESSLDPPKVLPPARHSTIPLVILRKKRGQASPLATGDCSSFIFADVSSSTPKRSPVKSLPFSPSQ,ILHHGVISAVLNSLKKQIFHLANITQAKPYSFSKERAMGLNLQENLAQGTNVCVRVHLTHPRSYLLQGTAQFHWSSFEKNGARPAPPLETVAPSYLLTSAVQLPSVPLSKAYPSLPR,FFIMVSQQFILRSRFFTPTSHRQSPTASAKRGQWDTCRRTPKGEQTYVEEFTPTQGLTSCKAQHNSTGHPSKKTGPGQPLSHWRLLLHICRQQFNSQAFPCQKPTLLSLA

Amino Acids from 3' Exons

FLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENT,STLPVTMKTQTWKCLLLPPPSLVTNLLQHHFIETRLKLKRKIL,LKHFQPKLRLGNAFFNFHPPHWSQIDCYNTISRPDCENSKGKYC