McDonnell Genome Institute

Washington University

CircRNA

chr6|133446629|133483115|+|EYA4|ENST00000355167.7

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9758

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

22

Peptide

LSGIWMKPSLFFTHCSPGLMHR

Amino Acids from 5' Exons

VYGNAGPSKSSYSCWRWYSRLQTGKISQQHISYYKWDR,SMEMQDLASPHTLVGGGDTPGSSKLEKSNLSSTSVTTNGTG,LWKCRTQVLILLLEVVILQVAPNWKNLISAAHQLLQMGQE

Amino Acids from 3' Exons

RVFVWDLDETIIVFHSLLTGSYAQKYGK,VCLSGIWMKPSLFFTHCSPGLMHRSMA,CVCLGFGNHHCFSLTAHRVLCTEVWQ