McDonnell Genome Institute

Washington University

CircRNA

chr6|131851141|131861704|+|ENPP1|ENST00000360971.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9156

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

CIMEHIWTCNK

Amino Acids from 5' Exons

NIYGLATNSGVVRKGPEASVPVQMTARTRATAASTTVLCVK,TYMDLQQIQVWEKVDQKPLCLFRLQGQGRLLHQLQFCVS,HIWTCNKFRCGEKRLTRSLCACSDDCKDKGDCCINYSSVCQ

Amino Acids from 3' Exons

IWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYN,FGSQLSIKASSLAHFSGQDQMWKLTEFSQTSIKCIM,LGHSVSRPQVWHIFLARIRCGNRNFPRHLNVW