McDonnell Genome Institute

Washington University

CircRNA

chr6|129629352|129642018|-|ARHGAP18|ENST00000368149.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9638

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

12

Peptide

GDDATLPSQIWPVHYEPGK

Amino Acids from 5' Exons

TRHLTLLVKRSSHLRRRLPLKQTSTWRYHLPSKHSIRKRAPRRKSRRAKAMMPHY,RGIPCWREADPTGDACPNRHQPGGIICRASTQSERELQGENPEEQRRCHIT,EASNLVGEEKLIPPEETPAPETDINLEVSFAEQALNQKESSKEKIQKSKGDDATLP

Amino Acids from 3' Exons

SQIWPVHYEPGKHHHQSYGEASISINFPGFFGTIYGRLLDRTRKHQEIKQPRRSRGGCCQRA,RRYGQYTMNQESTTIKVMEKPPFDRSISQDSLDELSMEDYWIELENIKKSSENSQEDQEVVVVKEPD,ADMASTLTRKAPPSKLWRSLHLIDQFPRILWMNYLWKTIGNKTSRNLVKTAKKIKRWLLSKSLM