McDonnell Genome Institute

Washington University

CircRNA

chr6|129445666|129465289|+|LAMA2|ENST00000421865.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

QVADADATVK

Amino Acids from 5' Exons

LPMQMPLSKINRKLTGINSNPSRNLRITRKTSLRRNTKLGNKPI,CRCRCHCQKFRTGSPANRTQTHQGTGPKEKHLDKGIDKPSSETSQF,ADADATVKNLEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANS

Amino Acids from 3' Exons

RDFMSVELTDGHIKVSYDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQ,EISVWSSLMGTKSVTIWAQEWLPLSAIKTIMMGNGNHSLCQEFKNK,RFHECGAHWAHKSQLRSGLRNGFRCQQSKPWEMEIIHSVKNSKT