McDonnell Genome Institute

Washington University

CircRNA

chr6|129353163|129440998|+|LAMA2|ENST00000421865.2

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.994

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

EGSVTAASTGMHAR

Amino Acids from 5' Exons

VCPWLYWQSRQPWRLLPRMVSLWLTACALPCHRILHVPTWSHGKEVRLQALACTRGLGVC,CAPGYTGSPGNPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGCKHWHAREGWECV,VPLAILAVQATLEAPAKNVSVIPMAHCLCPVTLSQDSARADLEPREGSVTAASTGMHARAGSVF

Amino Acids from 3' Exons

IQLLNCKLLRTKPDKPTTQLKMYWHRLQSSTRTSMARRITINQTASPKRMLWLKILPRT,YSCTASCGQSQTSQRHSRCTGTDYRAPPEPRWPEEELQTSRQRRQNECCGRSFQE,TAAKLQAVKDKARQANDTAKDVLAQITELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKN