McDonnell Genome Institute

Washington University

CircRNA

chr6|128067518|128078918|-|PTPRK|ENST00000368207.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9321

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

ELMPLSMK

Amino Acids from 5' Exons

CLSDCCGRTAPTPNQERSRSHGMLPGSCHIPKCHEWGCTVLLCCRTPPGKPTACPVHCGQSDLPRLLEPSFGSAQRIQHLFPGDEQCGE,AYQIVVEELHPHRTKREAGAMECYQVPVTYQNAMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEK,LIRLLWKNCTHTEPREKPEPWNATRFLSHTKMPVGVHRITLLQNSPRETYLSLPRSLWVTIGPTKAFGTLLWLRAKDTTSISRRAVWR

Amino Acids from 3' Exons

LQLYLTMKELMPLSMKLPPQLYCDQHKPKVLLS,SNFTLRSCLSQNCHHNNCIVETSTSQRCSYQ,PTLPDYEGVDASLNETATTITVLLRPAQAKGAPI