McDonnell Genome Institute

Washington University

CircRNA

chr6|127995461|128005244|-|PTPRK|ENST00000368207.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9207

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

MILPQIILMPTILIK

Amino Acids from 5' Exons

MITPEFCNPRMILPQIILMPTIL,SLQSDFATRRGSFLRLYCQLY,DHSRVILQPVEDDPSSDYINANYID

Amino Acids from 3' Exons

QTCKTQRCHGEYPAGDDSHGECNGSKLCSEHSACRRSSFHHLHGPTLSK,KLAKKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPR,NLLKNAKMPWGIPGRRLTWMQWIEVMLIRALCMQKILFPSPSWTNITLVQD