McDonnell Genome Institute

Washington University

CircRNA

chr6|125919304|125921068|+|NCOA7|ENST00000438495.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

17

3

Peptide

LPLDIQIFYCARPDEEPFVK

Amino Acids from 5' Exons

RENLFLIRERATLLTAHNERPKITLGHPDFLLCQTRRAFCE,EKTCSSLEREPHFSLLTMRGQRLPLDIQIFYCARPDEEPFVK,RKLVPHRESHTSHCSQEAKDYPWTSRFSIVPDLTKSLL

Amino Acids from 3' Exons

IITVEEAKRRKSTCSYYEDEDEEVLPVLRPHSALLENMHIEQ,SSLLKRQSAGRAHAATMKTRTKRCCLSYGPTARSWRICTSS,HHCRGKAQEEHMQLLRRGRRGAACPTAPQRAPGEYAHRA