McDonnell Genome Institute

Washington University

CircRNA

chr6|12015525|12125870|+|HIVEP1|ENST00000379388.6

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

24

Peptide

IGAFYDDVFVSGPNAPVPQSGHPR

Amino Acids from 5' Exons

HMDLMYVEFMELPFGGLLYLQFLRRKRRPVKEDASNTNSSQKSK,TWINCMLSLWSCLLVACFICSFEEKEGPESKKMPRTKQIHPRNLR,HGLIDVCVYGAAFWWLALSAVFKKKKKALSQRRCLELNKFIPEIE

Amino Acids from 3' Exons

KSYRLVLKELRNPLKVNAKRSLRITKKYQNPHEILFRQNINKIQKSHLSPFFIVLRSLTRNRIIFLKMGSSLPNKMEKHLELLKPQNLKNLSPQRSPCFCSNHLNCVDGDPKALILPNSVTSMNNVTQVPCQVKPGLTIANASLLIVALRPPPIQTLHSMSYKQWSQNAPCHKRAHLVQLRQKNGQIKLHVPLPNKTVQWMPQIRLHRNWLLNHSLLVPHTQSICLLLRRMSKGQCSQLLICIINMNTLFPNPTNIINSFRGVQVSQDHQICKIKRMPNLNRFIIQHHLALHLPVDLRLLLKTSKWILLHLCQVRLILHSRPPCQSIIQLMLPLLLIKASKCAIFFKIRSQKNKENIFVSIAIEHVQSLVCFSISAPTLESDPIPVLVDFHLRLKVICISTRNPTHILSNWVLSCNQMLVACSCPTSPPKHLVFIQTKTVGRARRKAPLMRDSMTWAPWSCSLCTRGCQMLKLYNQASLQAVQKMVTFCYRTDLQNHKLQSYRKLWSTMSLCPPELTVQRPWIPSLNFLVHKSRRTFRQTYSHFQPTCPRVESPGWRLMRIPTRKATIHWKESKTLTERYTPSYKGSRLPITPKSSKESSVLEVEVRILVTFHVLKVPIKQVHQLPLPEGYPAQNKTLEGVTDPLQLLSPRQHPLLCPQGKRHCFYQVRCAHLWPQKHLRSGYRSLSQTMKLWMTSNWIVSRGEPHCQDEEALIPPNHTYLKILSSLINQWDGEQVQALIYRSHLSPLLKNQSKCFFCLYLHLTVYLSQEVIPCRPQVIQQYLQIYLLLIHEEVSHLMTKLALSMMMSLYRDLTLLCPRVGIPVHLDKQPKTLQQMKVMFLVLDSPWMRATKDAMLLVKPCQGARHWHKAHIKKRSLIKGEGQCLSVKLVETGIGNWKILKIIRNFTVLSYMDQKQRPENLSTALCPAVCSLRFYTTESLGPPASGNRRPREKGGKKVLGMMKNFSKMKVEHLQKVLKAFSFRMLWAVIPVCLNIMLPEVTSSIKIYSCKTPIFTLLPGALSRPWIPSCRPSWNNRVQQPRTRNCRDTELESLSSSTPTPAGPTHLTSLSLLKEPPQFLSRSIERGSPGLKESPKRKVTLLGTGLILTSLHYQTLSEENFRKAPERVQVNDMCDSPQDLSGSTTSKFQRFWSQKNQIETWKLNAMIKKSQRSSVGPSVVKPCQNCQQRNCHPKRKGSVWLRNIPQQNRALIPLSPGVVGRAVYLTLQVSQPLTRTFLKRRLPPKSIFIKPSFLFQLAILMFLDVTGKGVLHQNRLIARKRQWRSLISEANHSIVEASPHPRQHHLLNCSLHLHLLEWELGMCLSKEGEAHWYGKYLTPQIVICLLYTQHLSKILLFPVMQCHIRGLSSLVHLLSFLQILCTLRLRLRICRQKHQTPALPTFFLFNSSVISICIKSMHRLATRAHSYLCKCLRRVASQIKILFYLGLLKVRIALLPNTNCIVRFSLQAHLALLILCILCQIKLFQIQLEQIIVHQQHYQPNLTACLIRILCYHQSSGPLEVRCRRCHHHSCCPYACRVVFLLTVLLHSHPCHKYPKICPISQFARLIIVCQSVKNKILCQHYKKVIRMLCQTQRRNFYVKMFFQRAKILLYQNPCPLRKYLLVDFPLNKNLQLRVKGCFPQQIVTLPWKSTRSGPKMKMELFVQQTDLRLVRELMKLVNRRSLFDRFVLQSPWTVCWKRMFFLNLKLVMRLLIQMFYQLIIHQQDALNLSLNLVNCRNLKTSSHPHHLLQFEVHLLLQKILIFLLNVQTITKKGSLQGLKIKVTKTSKSKVNSQSLLFHCLTSRTPSSWLSLAKLQPTLHGVISGRSRCICLRRTRKLQPILIGQAPVIQIHSVCPQKLHLLSLIQNRTLENHYTVKQLPIPSQTYWSIQASGKAAA,NLTGWCRNFGIPRCETQKDRSESPEKNTKIPTEKSSSGKTTKYRRVIFRRSSCFGVSQETELYSCKKWEAVYQTKWRNTWNNCSLKIRICLPKEALVSAATITAMEIRRRSCQIQPRTMLKFLVKNQDQRMHLFSLWHYVPLLYKHCIRCLTESNGARTEHLVTKGLTLCNDRKTEAKNCTFPSQIKKQFNGCPKSDFTGIGCITVFLYLIHSPYVCCSEEARGNAVSFSFVSSTTLCSQIQPTSTASGVFRFHRITDKSAKSRECQTTGLYSSDIICRPNFTFQISGYSSKPANGFCFTFVNKSGFYTVAPHANLFNSCCLCCSKRRANVQSSSERSEAKKTRKIYLVLQSMCKACAFKAYPLPHWRATLSLCDLWIFIDKSVAQEIPRTYYQTGSCLATRCWWLVLVPRVPQSTYSFRRRRQWGERGGRRHETAPGRHGAAACAHNKEDVKCNFTKIKLHSKQSRKCDRLFATGQICRITSCDRVTESCGPPCHCVPLKNQSKGHGSQATFCTKAEGPSGDKRTATFSQHVPGWSLQVGDEFPPERRHESTGRKARLSRRNGTRPATKAAGYRLLPRAARKAPESSKFRKYGFWLLFTFKCRSNSESTNSLCQKVTQHRTRLWKERTLCSSCHHVNTLCFAHRGKGIAFTRSDAPTFGHKNTGADIEAYLRQSFGRQATGCEAAENLTVKTRKHFPQIIHIRFFPVFKTSGTENKFKLYTEVTFHPYKIKASVSSVCTFTLFTYHKKFHADHRLFSSTCKYNTSSSSTKRKSVIQNWRFLCLCIGTRSCAPEWASPYTCETSSHRRLFSKKSCSWYWTVPGEPPRMPCCWSHVSEEQGTGTRPTYRKKEVSSRARDNVVNLKQVETGKFKSEILLFVTWTKNKGSHERTAQPCARRSAASDSTLQSRWVLRHLGTDAPDKKKEENEKCWGRTSAKKWNISKKFRPSVSECSGLSQFATCYHKKPAAKYTVAKLPYSPCCQGPADHGSQAVDHHGTTDKFSSPGQDRTAETRNWNLCHPAHQLPEQAQLIQAAFKSLPSFFPGAENGEVRVSKSDRNLPRGKSPFSGRVSSSPACTIRRSQRRTSGKLQKESKTTCVRTALKTCPAAQHPSSRDFGHRRTRSRPGSSMPSRKVREVQLAPANLVKIANRETATQKEKAPSGDRTFLNRIELFHSLQESKGEQFISHFKFLSLFRHRGRFNGGFPQNRFSKSRVSYDSSWLEYSECSWMSPGNEAYCIRTDLHANVNGGLSQKQIIRLWKHHPTPDNTTYIAASIFTFSSGSDWACASLRKKERPTGTANIFKHSPRSSVSCTPNIFPKYCSSQCECSAISGASAHYIFSVFCKYFALSDSGGSAGRNIKLQLYQRFSCSTALYQFVKSNPCTAPPEHTAISASVYAGQARKFCFIWVFKGLLCSQIPIALSGFHFRPILLFSCAFFAKSSYFRSSWNRSLCDISNITNQINQHVFASSATTRAQAPWKSGAEGAIIIHAAHTPAECSCLLFCYTHIPATNTSDPRSAQSANLPDSCSANQRTKFCANITKRSSECFAKPREGISMKCFFRDEPKFFSIRILAHNSENICWSTFPSTRIFSFEKDAFPSKFRHCHGKAPEAGQRKWSCLCNRRETFRGFEFESSTEEAYFSETGLYYRAPGRCDVGKGCFFSTNGCFDKCFTSFINRMLICRYRTYKIAGIKHQVIHIINSYSSKFTCSFRKYSYFSFEMYRQPRKEVSRGKSRQSEHPRAKSTASHFSFIVHQGHPAAGFPPENYNQLYMVLSLKAEVVAFASEGPENFSLYLDSKRQSKSTRFAHKSCTCSPFKTEHWKITILSSNNYPFQVRLIGLFKQVEKQLKQ,ILQAGVKGTSESLKGVKRKKIVAENHLKKIPKSPLRNPLQAKHKQNTEESSFAVLHSASESHKKQNYIPVKNGKQFTKQNGETPGIIAEASKSEESVSPKKPLFLQQPSELRRWRSEGADPAKFSDLDEQCDSSSLSSKTRTDNSECISSHCGTTSPSYTNTAFDVLLKAMEPELSTLSQKGSPCAIKTEKLRPNKTARSPPKLKNSSMDAPNQTSQELVAESQSSCTSYTVHMSAAQKNEQGAMQSASHLYHQHEHFVPKSNQHNQQLPGCSGFTGSLTNLQNQENAKLEQVYNIAVTSSVGLTSPSSRSQVTPQNQQMDSASPLSISPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKPKKQGKYICEYCNRACAKPSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSHESPKALSIHSDVEDSGESEEEGATDERQHDLGAMELQPVHIIKRMSNAETLLKSSFTPSSPENVIGDFLLQDRSAESQAVTELPKVVVHHVTVSPLRTDSPKAMDPKPELSSAQKQKDLQVTNVQPLSANMSQGGVSRLETNENSHQKGDMNPLEGKQDSHVGTVHAQLQRQQATDYSQEQQGKLLSPRSLGSTDSGYFSRSESADQTVSPPTPFARRLPSTEQDSGRSNGPSAALVTTSTPSALPTGEKALLLPGQMRPPLATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQFDLKPVGRRTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAVPANIIPPPHPLRGSQSFDDKIGAFYDDVFVSGPNAPVPQSGHPRTLVRQAAIEDSSANESHVLGTGQSLDESHQGCHAAGEAMSVRSKALAQGPHIEKKKSHQGRGTMFECETCRNRYRKLENFENHKKFYCSELHGPKTKVAMREPEHSPVPGGLQPQILHYRVAGSSGIWEQTPQIRKRRKMKSVGDDEELQQNESGTSPKSSEGLQFQNALGCNPSLPKHNVTIRSDQQHKNIQLQNSHIHLVARGPEQTMDPKLSTIMEQQISSAAQDKIELQRHGTGISVIQHTNSLSRPNSFDKPEPFERASPVSFQELNRTGKSGSLKVIGISQEESHPSRDGSHPHQLALSDALRGELQESSRKSPSERHVLGQPSRLVRQHNIQVPEILVTEEPDRDLEAQCHDQEKSEKFSWPQRSETLSKLPTEKLPPKKKRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHTSSFSASLDIEDVSKTEASPKIDFLNKAEFLMIPAGLNTLNVPGCHREMRRTASEQINCTQTSMEVSDLRSKSFDCGSITPPQTTPLTELQPPSSPSRVGVTGHVPLLERRRGPLVRQISLNIAPDSHLSPVHPTSFQNTALPSVNAVPYQGPQLTSTSLAEFSANTLHSQTQVKDLQAETSNSSSTNVFPVQQLCDINLLNQIHAPPSHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATLPTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQPICQTNHSVVPISEEQNSVPTLQKGHQNALPNPEKEFLCENVFSEMSQNSSLSESLPITQKISVGRLSPQQESSASSKRMLSPANSLDIAMEKHQKRAKDENGAVCATDVRPLEALSSRVNEASKQKKPILVRQVCTTEPLDGVMLEKDVFSQPEISNEAVNLTNVLPADNSSTGCSKFVVIEPISELQEFENIKSSTSLTLTVRSSPAPSENTHISPLKCTDNNQERKSPGVKNQGDKVNIQEQSQQPVTSLSLFNIKDTQQLAFPSLKTTTNFTWCYLLRQKSLHLPQKDQKTSAYTDWTVSASNPNPLGLPTKVALALLNSKQNTGKSLYCQAITTHSKSDLLVYSSKWKSSLSK