McDonnell Genome Institute

Washington University

CircRNA

chr6|119248259|119349287|-|MAN1A1|ENST00000368468.3

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9882

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

23

Peptide

GAAPGRRPGAELFPQGGSAAQPR

Amino Acids from 5' Exons

IFRKKAVELGVKLLPAFHTPSGIPWALLNMK,FFERKQWNLGNCYLHFILPLEYLGHCIK,FSKESSGTWGKIATCISYSLWNTLGIAEYEK,IFRKKAVELGVKLLPAFHTPSGIPWALLNMK,FFERKQWNLGNCYLHFILPLEYLGHCIK,FSKESSGTWGKIATCISYSLWNTLGIAEYEK

Amino Acids from 3' Exons

GLQPAVCRACLCARGAAPGRRPGAELFPQGGSAAQPRGSGGLATQDPAPQPRTPSGGEVWLLSGAAPDHWTAGAMPVGGLLPLFSSPAGGVLGGGLGGGGGRKGSGPAALRLTEKFVLLLVFSAFITLCFGAIFFLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAAEGRARRREEGAPGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKIKE,GCSQRSVARACVPEEPPRGEDPARSCSPREDPQPSRGGRAAWLRRTQPRSRGLPAAAKFGCAARRRTTGQRERCPWGACCRSSAAPRAASWAGGSAAAVAGRGRAPPPSARRSSCCCWYSAPSSRSASGRSSSCQTPPSCSAGSCSTPAPPCSRPPTTSPGPGRAPRTRPRGEPGAARRGHPGTRRPPWRTTWPGSAKTTSGLSGKPRRPCRSCPRRSKETSYWRRRRWPRTSCVTRRRSEACPRWTSCPQSGWRAGSPPTPPSARKGQRSK,AAASGLSRVPVCPRSRPGEKTRRGVVPPGRIRSPAEGVGRPGYAGPSPAAADSQRRRSLAAERRGAGPLDSGSDARGGPVAALQQPRGRRPGRGARRRRWQEGVGPRRPPPDGEVRAAAGIQRLHHALLRGDLLPARLLQAAQRGPVPLQPRLAAGRRPQARARGARRGRGRGASPAPRGGGTRGPGGRPGGQLGQDPRKPRAGSQGSQGDPAEAARGDPKRHPTGEEEGGPGPAAQGAVQRPAPGGLRAPNRGGEPGARRRRHPREKGKDQR,GLQPAVCRACLCARGAAPGRRPGAELFPQGGSAAQPRGSGGLATQDPAPQPRTPSGGEVWLLSGAAPDHWTAGAMPVGGLLPLFSSPAGGVLGGGLGGGGGRKGSGPAALRLTEKFVLLLVFSAFITLCFGAIFFLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAAEGRARRREEGAPGDPEAALEDNLARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREKRAKIKE,GCSQRSVARACVPEEPPRGEDPARSCSPREDPQPSRGGRAAWLRRTQPRSRGLPAAAKFGCAARRRTTGQRERCPWGACCRSSAAPRAASWAGGSAAAVAGRGRAPPPSARRSSCCCWYSAPSSRSASGRSSSCQTPPSCSAGSCSTPAPPCSRPPTTSPGPGRAPRTRPRGEPGAARRGHPGTRRPPWRTTWPGSAKTTSGLSGKPRRPCRSCPRRSKETSYWRRRRWPRTSCVTRRRSEACPRWTSCPQSGWRAGSPPTPPSARKGQRSK,AAASGLSRVPVCPRSRPGEKTRRGVVPPGRIRSPAEGVGRPGYAGPSPAAADSQRRRSLAAERRGAGPLDSGSDARGGPVAALQQPRGRRPGRGARRRRWQEGVGPRRPPPDGEVRAAAGIQRLHHALLRGDLLPARLLQAAQRGPVPLQPRLAAGRRPQARARGARRGRGRGASPAPRGGGTRGPGGRPGGQLGQDPRKPRAGSQGSQGDPAEAARGDPKRHPTGEEEGGPGPAAQGAVQRPAPGGLRAPNRGGEPGARRRRHPREKGKDQR