McDonnell Genome Institute

Washington University

CircRNA

chr6|119189663|119193892|-|MAN1A1|ENST00000368468.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9212

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

17

Peptide

TYHVSVGGLGDSFYEYLLK

Amino Acids from 5' Exons

AIETHLIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGGMFALGADAAPEGMAQHYLELGAEIARTCHESYNRT,LSRLISASLAADLISQSGKGASWSTRWATPASRGACSHSGLMQLPKAWPNTTLNSGLKLPVLVMNHIIEH,YRDSFDPQVQRTNLYRRVERGPPGAQDGPPDLLRGGHVRTRGCSSRRHGPTLPTRGNCPYLSIISN

Amino Acids from 3' Exons

IMYQLEDLETASMSICRPGCLTRQIWKLRRCILMLF,SCISWRTWRQLLVFAEGLVNVQDRSGSEDVFCCS,HVSVGGLGDSFYEYLLKAWLMSDKTDLEAKKMYFDAVQ