McDonnell Genome Institute

Washington University

CircRNA

chr6|119188404|119204882|-|MAN1A1|ENST00000368468.3

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9863

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

ELALGLWR

Amino Acids from 5' Exons

LNWDQKLSDLMVVLKPSLQDKMKNTTSYGQKLWRLTCICGDLMIQSTGNGPGKP,YETGTRSFQIWWCSHRYKTKKILHLTARSYGDLHVYVETDSSKVQEMGLGSRR,MKLGPEAFRFDGGVEAIATRQNEKYYILRPEVMETYMYMWRLTHDPKYRKWAWEAVE

Amino Acids from 3' Exons

WYWKELALGLWRQQYSGRIWNPAFGVYALEPLIRKPHLCK,GIGRNWPWASGGSSILAEFGTLHLEFMHLSHLSGNPIFAEK,VLEGTGPGPLEAAVFWQNLEPCIWSLCTATYQETPSLLK