McDonnell Genome Institute

Washington University

CircRNA

chr6|116399197|116399666|+|DSE|ENST00000331677.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9918

37

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LLCVSLHHRR

Amino Acids from 5' Exons

DLSKMVWLPWRFGDLMPRGLTHGGLPVCFSYICFALCQPTSPTRTQKLFPSPMPTTTAIPCCTSPGQKWRSCSSGLPARTSTLQPASRRLCTRCCPAPWNTSLPGIPRTTVPAGMKFLETTWVPWQCSVCCILRTLKPETWPKTTWRGWQRSLV,IFRRWFGCLGDLEICHDEDSHTGGSQCVFHIFALLCVSLHHRREPRSYDSLHQCQLRQPSHAVLLQGRSGGAAAQGCQLARAHCSPPHGGCAHDAVQPLGIPPSLGSQGLQCPLENFWKQLGCLGNVLCAVSEHSPRHGQRLHGEDGSAAL,SFEDGLAALEIWRSDATMRTHTRGAPSVFFIYLLCFVSAYITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRAASSHEHIAARLTEAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENIEARDMAKDYMERMAAQPS

Amino Acids from 3' Exons

DLSKMVWLPWRFGDLMPRGLTHGGLPVCFSYICFALCQPTSPTRTQKLFPSPMPTTTAIPCCTSPGQKWRSCSSGLPARTSTLQPASRRLCTRCCPAPWNTSLPGIPRTTVPAGMKFLETTWVPWQCSVCCILRTLKPETWPKTTWRGWQRSLV,IFRRWFGCLGDLEICHDEDSHTGGSQCVFHIFALLCVSLHHRREPRSYDSLHQCQLRQPSHAVLLQGRSGGAAAQGCQLARAHCSPPHGGCAHDAVQPLGIPPSLGSQGLQCPLENFWKQLGCLGNVLCAVSEHSPRHGQRLHGEDGSAAL,SFEDGLAALEIWRSDATMRTHTRGAPSVFFIYLLCFVSAYITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRAASSHEHIAARLTEAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENIEARDMAKDYMERMAAQPS