McDonnell Genome Institute

Washington University

CircRNA

chr6|113944279|113956151|-|HDAC2|ENST00000368632.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9008

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

ISTGAVK

Amino Acids from 5' Exons

TAFVKFAHVTSCTWCPDASYSRRCCSRQWRRWRRSRQENF,QRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRIS,SVCLKICACYLMHLVSRCKLFQKMLFMKTVEMKMEKIQTREFL

Amino Acids from 3' Exons

LELSTDNRLIWLLIGLEDYIMLRNQKHQDSVTLMILCLPSLNY,WSCEVKPTTDYGCLGWRITSCEIRSIRILLRYCACHPITK,GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELL