McDonnell Genome Institute

Washington University

CircRNA

chr6|112178120|112187601|-|LAMA4|ENST00000230538.11

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

54

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

CVWDLTDDLR

Amino Acids from 5' Exons

ENQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQ,KIKPPEKDNLFRRKAWTPLTTQVSWSKPMIGIKSK,KSSLQKRTTCSEGKHGHHPRKSAGRASPYEGNP

Amino Acids from 3' Exons

AVISASGTLMTCGQRSPSRKANPGCAYPLGPPLIGTMKSTPPSTSS,LVRLGPDPAVSSALHRGRQIRGAERILWGRRSARENQRHHLPPQ,CDKCVWDLTDDLRLAALSIEEGKSGVLSVSSGAAAHRHVNEINATIYLLK