McDonnell Genome Institute

Washington University

CircRNA

chr6|111719804|111846629|-|FYN|ENST00000354650.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9893

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

QDADLNVEK

Amino Acids from 5' Exons

EFRWAVCNVRIKKQQNRRRGTAATRALGTAMAQTPPLSTTPASVPPSPTTTTSTQPGAKDSPSLEVTLRLIRGPCVREEEQ,NLDNGLCAMGRSNKTDGGEGRQPEPELWVPLWHRPHPSALPQLRCDLHPQLQQLPRSRGPRTHRLWRCELFVSYGDLAYERRN,IIMGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGT

Amino Acids from 3' Exons

FFRSRMLITWK,FFEEAGCSKRGK,FLKKQDADLNVEK