McDonnell Genome Institute

Washington University

CircRNA

chr6|109451599|109452615|-|MICAL1|ENST00000358577.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9383

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LQEVNSSLK

Amino Acids from 5' Exons

ALIWRTLCTTRTTPTTLQPRSSACCGWGCCA,HSGEHCVLQGRHPLLCDDSQEAVPAAAGGAAP,IDLENIVYYKDDTHYFVMTAKKQCLLRLGVLRQ

Amino Acids from 3' Exons

GVAGVPSSNPTPLPSWPTMNLTSLSRLQEVNSSLK,EWLACPAPTQPPCPAGQLIRPYLGCRRIRP,SGWRAQLQPNPPAQLANYEFDVLISAAGGKFVPE