McDonnell Genome Institute

Washington University

CircRNA

chr6|108323824|108324048|+|LACE1|ENST00000368977.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9919

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

GYNIEAEGLFSKPIR

Amino Acids from 5' Exons

PIRFRHPRAPQLPLQRLIKLWPFAMDLWTTMIFSKLMSRMMNIKEESYSVCRNYTRTLKDTIRQKAFFQ,LYGSDIREHDPNCHFRDLFESFGRLPWTSGPLFSDQSSAKGTSKKSHTVFAEITRGPRIQYRGRRPFFK,YTVQTSESMTPTATSETYLKALAVCHGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSK

Amino Acids from 3' Exons

PIRFRHPRAPQLPLQRLIKLWPFAMDLWTTMIFSKLMSRMMNIKEESYSVCRNYTRTLKDTIRQKAFFQ,LYGSDIREHDPNCHFRDLFESFGRLPWTSGPLFSDQSSAKGTSKKSHTVFAEITRGPRIQYRGRRPFFK,YTVQTSESMTPTATSETYLKALAVCHGPLDHYDFLIKAHELKDDEHQRRVIQCLQKLHEDLKGYNIEAEGLFSK