McDonnell Genome Institute

Washington University

CircRNA

chr6|107210438|107274227|-|PDSS2|ENST00000369037.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9881

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

LEEICGLNR

Amino Acids from 5' Exons

INSDVQPFIKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGE,ILMSSLLLKKRPVTPLLITQLLSYIRNFLEEICGLNRSE,KFCPAFYRKDQLHDFSKLSSCSLTSGISWKRFVDTDRR

Amino Acids from 3' Exons

SKKFGRDHGANSYCSPCTSWDSKFKVAIIWSTERHAIWKNCYPEWRLSSSKCLQWTSSATEHQ,QRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKDMQFGNKIAILSGDFLLANACNGLALLQNTK,KEVWQRSRSFILLSLYIVGIMSCNHLMVHKTCNLEIKLLSVETFFQMPAMDLCYRTP