McDonnell Genome Institute

Washington University

CircRNA

chr6|106560802|106563926|+|AIM1|ENST00000369066.7

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9703

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

2

Peptide

DGLLMNMAVTEGDSSYCHLQK

Amino Acids from 5' Exons

MGYLIWQLQRATVPIVTCRSTLVIQWLSPNRFSTTFCS,WVTYEYGSYRGRQFLLSPAEVPNWYEFSGCRQIGSLRPFVQ,GLLMNMAVTEGDSSYCHLQKYLIGMNSVAVAKVLYDLLF

Amino Acids from 3' Exons

IAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLKSDGRIYSKLKPNLVLDIK,QKTAARLWAAWHLAPSAWPWTRMLTASSGASPMAGFTASSQIFTLK,SRRLLPDDCGQPGNIWLQARPGPGPECQPVLELEVRWQDLQQVEAKFSFRH