McDonnell Genome Institute

Washington University

CircRNA

chr6|105373368|105377519|-|PREP|ENST00000369110.7

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9409

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

ESSSAVWPGPMMGR

Amino Acids from 5' Exons

VMRSAKMVNILPMVVPVAQTGQSSSKLMVPKSFQMCLKESSSAVWPGPMMGRECSTTHTLNRMEKVM,LCVQRRWIFCLWSECQWLRLGDNQVHESWCQRASRCAKSQVQLYGLDPWEGNVLQLIPSTGWKK,YAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSD

Amino Acids from 3' Exons

AFVEAQNKITVPFLEQCPIRGLYKERMTELYDYPKYSCHFKKGK,PLWRPRIRLLCHFLSSVPSEVYTKRELNYMIIPSIVATSRKEN,LCGGPEDYCAISAVSHQRFIQRENDTILSQVLPLQERKT